General Information

  • ID:  hor001400
  • Uniprot ID:  A0A921YJF1
  • Protein name:  FLRFamide II
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  GNSFLRF
  • Length:  7
  • Propeptide:  MSCSRCMVVFAALVLVIGATASPVRRSPDLEARRRSAIDRSMIRYSTPCNYDRMDSSGYRFGRSYPPEPSAADIRDAFRTRRGNSFLRFGRSQPMTLTSDDLISLLRAYEEDYDSPVSKKSASFVRFGRDPSFIRFGRSADDEKVAFEAPAGNTYPQRKHRARDHFIRLGRDSEELNEENFDEDMESRRKRAAECSDCA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001400_AF2.pdbhor001400_ESM.pdb

Physical Information

Mass: 94714 Formula: C39H57N11O10
Absent amino acids: ACDEHIKMPQTVWY Common amino acids: F
pI: 10.55 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: 2.86 Boman Index: -1314
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 2267.14 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  14599724
  • Title:  A Comparison of the Neuropeptides From the Retrocerebral Complex of Adult Male and Female Manduca Sexta Using MALDI-TOF Mass Spectrometry